PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00427.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 472aa    MW: 51005.9 Da    PI: 8.7968
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00427.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.52.5e-12338396563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              kr +r   NR++A rs +RK ++++eLe kv++L++e ++L  +l +l+  +  l++++
  Rsa1.0_00427.1_g00007.1 338 KRVKRILANRVSAARSKERKTQYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQN 396
                              899*********************************************99888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-19334398IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898336399IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-10338395No hitNo description
SuperFamilySSF579595.98E-12338394No hitNo description
PfamPF001703.4E-10338395IPR004827Basic-leucine zipper domain
CDDcd147031.82E-22339388No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MGGGSGTDTT SMTQRPSSIP KQQPPLIPNH HLNPPPPPLI RSSSPQPFTA GTPPPIPPYS  60
QIPATLQLKH SRSTSQPSSF FSFDSLPPLN PSPLPVSSAE ERNGAGFSPS LPPSPFTMCH  120
STSRIIGDGP ENLPPRKSHR RSNSDVTFGF ISSSLKSPPL IPSSRSLERS VSGGGGEGAC  180
ASDWSNLVKE EPGRRSESEA MDDIFKAYMN LDNIDVLNSF GGEEMESSGT RKTASSDSEG  240
ESSAACGNNV KVSSGVKRRA GGDIAPPTSR HYRSVSMDSG FMGKLDFGGG GDDNKLPLTS  300
SGEGNSSFEF GNGEFTAAEM KKISADEKLA EIVMSDPKRV KRILANRVSA ARSKERKTQY  360
MAELEHKVQT LQTEATTLSA QLTHLQRDSM GLTNQNSELK FRLQAMEQQA QLRDALSEKL  420
TEEVQRLKLV IGETSSRSRR ESNISKTALS PEMFQQLSIS QQQMQHSKAQ IK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1350358ARSKERKTQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637267.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_013637268.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A0D3C0Y60.0A0A0D3C0Y6_BRAOL; Uncharacterized protein
STRINGBra030314.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156251417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.11e-138bZIP family protein